nicotinamide mononucleotide comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-03-03. Where a claim depends on a specific study, the study is described rather than over-claimed.
Quality control for NMN focuses on identity, purity, residual solvents, heavy metals, and microbial limits. Because the molecule can absorb water, moisture content and packaging are relevant to shelf life. Suppliers may provide certificates of analysis, but independent verification is often needed for research or commercial use. The long-term stability of different crystal forms, salt forms, and formulations is not fully characterized in the public literature. Some degradation products and their effects on product performance remain open questions.
As a commercial ingredient, nicotinamide mononucleotide is commonly supplied as a powder or capsule. Its stability depends on temperature, moisture, pH, and light exposure. Hydrolytic and thermal degradation can increase over time, so manufacturers and laboratories often store material cold and dry. Purity is typically assessed with chromatographic methods, and identity can be confirmed by mass spectrometry. Published stability data for specific finished products remain limited. More data would help define shelf life under real-world conditions.
NMN occurs in many living systems, including bacteria, yeast, plants, and mammals. Dietary sources are present in foods such as edamame, avocado, broccoli, and various meats, but amounts vary widely and are generally lower than those used in research settings. Laboratory production often relies on enzymatic synthesis or chemical phosphorylation of nicotinamide riboside, and commercial material is typically supplied as a white to off-white powder. Because NMN is hygroscopic and sensitive to heat, moisture, and pH extremes, its handling requires care to preserve identity and purity. Aqueous preparation should be done with attention to pH and temperature to limit hydrolysis.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure consists of a nicotinamide ring linked to ribose phosphate, and the compound serves as an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+. In this pathway, nicotinamide phosphoribosyltransferase converts nicotinamide and phosphoribosyl pyrophosphate into NMN, after which NMN adenylyltransferase attaches an adenylate group to produce NAD+. Because NAD+ participates in redox reactions and signaling, NMN occupies a central position in cellular metabolism. The molecule is distinct from nicotinamide riboside, though the two are related in NAD+ precursor research.
Beyond its intracellular synthesis, NMN can be taken up from the extracellular environment, although the routes are still debated. Some evidence points to direct transport into cells through specific transporters, while other work suggests dephosphorylation to nicotinamide riboside followed by cellular uptake. Once inside, NMN can be converted to NAD+ by NMN adenylyltransferases; the relative contribution of these routes may differ by tissue, species, and experimental conditions. Researchers continue to investigate which mechanisms dominate in intact organisms and how they affect measured NAD+ levels. Direct measurement in tissues remains technically challenging because NMN can be rapidly metabolized during sample collection.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | 2-8 °C or below | For laboratory samples; follow supplier guidance |
| Light sensitivity | Protect from light | Exposure may accelerate degradation |
| Moisture sensitivity | Hygroscopic | Use sealed containers and desiccant |
| Common purity assay | HPLC-UV or LC-MS | Purity often reported as area percent |
| Regulatory status | Varies by country | Supplement, novel food, or drug categories differ |
Quality control for NMN materials typically includes identity, assay, purity, and impurity profiling. Tests may cover residual solvents, heavy metals, microbial limits, and water content, depending on the intended use and local rules. Impurity profiles can include related substances such as nicotinamide, nicotinamide riboside, and NAD+, which may form during synthesis or storage. Because commercial NMN can be offered as different salts or hydrate forms, a certificate of analysis should state the form and the analytical methods used. Independent verification is relevant because supplement markets vary in testing requirements and enforcement.
Laboratory identification of NMN usually relies on chromatographic separation coupled with ultraviolet or mass spectrometric detection. High-performance liquid chromatography with UV absorbance can quantify the compound against a reference standard, while liquid chromatography-tandem mass spectrometry offers lower detection limits and better specificity in complex matrices. Nuclear magnetic resonance spectroscopy can confirm structural identity and isomeric form. Ion chromatography or capillary electrophoresis may be used to identify counterions such as sodium. Method validation includes accuracy, precision, linearity, and limits of detection.
Stability testing examines how temperature, humidity, light, and pH affect NMN over time. The compound is generally stored cold, often at minus twenty degrees Celsius or lower, in a desiccated container protected from light. Aqueous solutions tend to be less stable than dry powder because hydrolysis and dephosphorylation can occur, potentially forming nicotinamide riboside or other degradation products. Stress studies may expose samples to heat, acid, base, oxidation, and strong light to identify likely degradation pathways. Results from such studies help define shelf life and handling recommendations, though exact stability depends on formulation and packaging.
Research interest in NMN increased after animal studies reported that oral or injected NMN can raise NAD+ levels in some tissues. How NMN is absorbed and distributed in humans is not fully established. Some evidence suggests extracellular NMN may be dephosphorylated to nicotinamide riboside before cellular uptake, while other studies propose specific transport routes. Direct human data on these mechanisms remain limited. Regulatory status also varies: in some countries NMN is treated as a dietary supplement, while elsewhere it is restricted or requires approval, and these differences affect labeling, sale, and research.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide found in the cells of many organisms. Its structure consists of a nicotinamide group linked to a ribose sugar that carries a phosphate group. NMN is an intermediate in the biosynthesis of nicotinamide adenine dinucleotide, or NAD+, a coenzyme involved in many metabolic reactions. The abbreviation usually refers to the beta anomer, though related forms can exist. In scientific literature, NMN is distinct from nicotinamide riboside, another NAD+ precursor.
In the NAD+ salvage pathway, the enzyme NAMPT converts nicotinamide and a phosphate-donor molecule into NMN. A second enzyme, NMNAT, then converts NMN into NAD+. Nicotinamide riboside can also enter this route after being converted to NMN by nicotinamide riboside kinases. Because NMN sits at a junction between precursor uptake and NAD+ formation, its cellular concentration is tightly linked to enzyme activity and tissue type. NAD+ participates in redox reactions, signaling, and DNA repair, and its levels decline with age in some animal models, though human evidence remains more limited and context-dependent.
Identity and purity are usually assessed with complementary methods. Nuclear magnetic resonance spectroscopy can confirm the molecular structure and distinguish anomeric forms. High-performance liquid chromatography with ultraviolet detection or mass spectrometry is common for assay and related-substance testing. Mass spectrometry also supports trace quantification in biological samples, often with isotope-labeled internal standards. Because NMN lacks a strong chromophore, some ultraviolet methods require careful wavelength selection or derivatization, and laboratories may validate each approach for its intended matrix.
Commercial NMN is produced through enzymatic or chemical routes, and the resulting material can vary in purity, counterion, and residual solvent content. Buyers typically rely on certificates of analysis, but independent verification through third-party laboratories provides stronger assurance. Regulatory treatment differs by country; in the United States, NMN has been subject to shifting guidance about its status as a dietary supplement, while other markets permit sales under local rules. No universal pharmacopeial monograph exists for NMN, so specifications often come from suppliers, research protocols, or regional requirements.
Solid NMN is generally handled as a moisture-sensitive compound. Dry material stored desiccated at low temperature, protected from light, tends to remain stable for extended periods. Aqueous solutions are less stable and can undergo hydrolysis, especially at elevated temperature or alkaline pH. The anomeric form also matters: beta-NMN is the naturally occurring form, while alpha-NMN can appear as a synthetic impurity. Purity and storage conditions therefore influence both analytical results and experimental reproducibility.
“Chemoinformatics and Molecular Simulation”; “Chemistry of Supramolecular Nano- and Biosystems”; “Methods of Analytical Chemistry”; “Physical-Chemical Methods in Chemistry”; “Petrochemistry and Catalysis”. Total number of students taking Bachelor, Specialist and master's degree programs is 472 (as of January, 2016).Departments of the Institute of Chemistry educate postgraduates in the following majors: 02.00.01 – Inorganic Chemistry; 02.00.02 – Analytical Chemistry; 02.00.03 – Organic Chemistry; 02.00.04 – Physical Chemistry; 02.00.08 – Chemistry of Organoelement Compounds. There are two dissertation councils functioning in the Institute of Chemistry for thesis defence in chemical sciences: Д 212.081.03 under the Federal State Autonomous Institution of Higher Education “Kazan (Volga Region) Federal University”; majors allowed for defence: 02.00.01 – Inorganic Chemistry; 02.00.08 – Chemistry of Organoelement Compounds; Chairman of the Council is Professor Vladimir I. Galkin, Doctor of Chemistry;
Hox genes play a massive role in some amphibians and reptiles in their ability to regenerate lost limbs, especially HoxA and HoxD genes. If the processes involved in forming new tissue can be reverse-engineered into humans, it may be possible to heal injuries of the spinal cord or brain, repair damaged organs and reduce scarring and fibrosis after surgery. Despite the large conservation of the Hox genes through evolution, mammals and humans specifically cannot regenerate any of their limbs. This raises a question as to why humans which also possess an analog to these genes cannot regrow and regenerate limbs. Beside the lack of specific growth factor, studies have shown that something as small as base pair differences between amphibian and human Hox analogs play a crucial role in human inability to reproduce limbs. Undifferentiated stem cells and the ability to have polarity in tissues is vital to this process.
== Decay == Thorium-232 has a half-life of 14 billion years; it is itself an essentially pure alpha emitter with its first decay product radium-228. Radium-228 is itself unstable and leads to a decay chain known as the thorium series, which terminates at stable lead-208. The intermediates in the thorium-232 decay chain are all relatively short-lived; the longest-lived intermediate decay products are radium-228 and thorium-228, with half-lives of 5.75 years and 1.91 years, respectively. All others have half-lives under four days. The main decay branches are shown below:
== Awards == Silver medal, 2022 International KIWIE Award Silver medal, 2023 International KIWIE Award. Women Inventor Award, INDECOPI. Top 10 iCAN Award, from Canada for her ongoing projects. Hipolito Unanue Institute Fountation Award, Best Scientific Research Work for the study "Frequency of CYP1A1*2A and deletion of the GSTM1 gene in the Peruvian mestizo population". Three gold medals, 2024 International KIWIE Awards
Irwin was the first to observe that if the size of the plastic zone around a crack is small compared to the size of the crack, the energy required to grow the crack will not be critically dependent on the state of stress (the plastic zone) at the crack tip. In other words, a purely elastic solution may be used to calculate the amount of energy available for fracture. The energy release rate for crack growth or strain energy release rate may then be calculated as the change in elastic strain energy per unit area of crack growth, i.e.,
Sources: en.wikipedia.org
==== Cancer health claims ==== The U.S. Food and Drug Administration initiated a process of reviewing and approving food and dietary supplement health claims in 1993. Reviews of petitions results in proposed claims being rejected or approved. If approved, specific wording is allowed on package labels. In 1999, a second process for claims review was created. If there is not a scientific consensus on the totality of the evidence, a Qualified Health Claim (QHC) may be established. The FDA does not "approve" qualified health claim petitions. Instead, it issues a Letter of Enforcement Discretion that includes very specific claim language and the restrictions on using that wording. The first QHCs relevant to vitamin E were issued in 2003: "Some scientific evidence suggests that consumption of antioxidant vitamins may reduce the risk of certain forms of cancer." In 2009, the claims became more specific, allowing that vitamin E might reduce the risk of renal, bladder and colorectal cancers, but with required mention that the evidence was deemed weak and the claimed benefits highly unlikely. A petition to add brain, cervical, gastric and lung cancers was rejected. A further revision, May 2012, allowed that vitamin E may reduce risk of renal, bladder and colorectal cancers, with a more concise qualifier sentence added: "FDA has concluded that there is very little scientific evidence for this claim." Any company product label making the cancer claims has to include a qualifier sentence.
== Motivation == FTIR is a method of measuring infrared absorption and emission spectra. For a discussion of why people measure infrared absorption and emission spectra, i.e. why and how substances absorb and emit infrared light, see the article: Infrared spectroscopy.
== Applications == Alpha emitters such as actinium-225 are favored in cancer treatment because of the short range (a few cell diameters) of alpha particles in tissue and their high energy, rendering them highly effective in targeting and killing cancer cells—specifically, alpha particles are more effective at breaking DNA strands. The 10-day half-life of 225Ac is long enough to facilitate distribution, but short enough that little remains in the body months after treatment. Additionally, each decay of 225Ac to 209Bi nets four high-energy alpha particles, greatly increasing its potency. Despite its limited availability, several clinical trials have been completed, demonstrating the effectiveness of 225Ac in targeted alpha therapy. Complexes including 225Ac—such as antibodies labeled with 225Ac—have been tested to target various types of cancer, including leukemia, prostate carcinoma, and breast carcinoma in humans. For example, one experimental 225Ac-based drug has shown effectiveness against acute myeloid leukemia without harming the patient. Further clinical trials of other drugs are underway such as the SatisfACtion trial (NCT04597411), a Phase I/II, open-label, multi-center study that is evaluating 225Ac-PSMA-R2 in patients with metastatic hormone-sensitive prostate cancer (mHSPC) and metastatic castration-resistant prostate cancer (mCRPC).
==== GnRH modulators ==== GnRH modulators are antigonadotropins and hence functional antiandrogens. In both males and females, gonadotropin-releasing hormone (GnRH) is produced in the hypothalamus and induces the secretion of the gonadotropins luteinizing hormone (LH) and follicle-stimulating hormone (FSH) from the pituitary gland. The gonadotropins signal the gonads to make sex hormones such as testosterone and estradiol. GnRH modulators bind to and inhibit the GnRH receptor, thereby preventing gonadotropin release. As a result of this, GnRH modulators are able to completely shut-down gonadal sex hormone production, and can decrease testosterone levels in men and transgender women by about 95%, or to an equivalent extent as surgical castration. GnRH modulators are also commonly known as GnRH analogues. However, not all clinically used GnRH modulators are analogues of GnRH. There are two types of GnRH modulators: GnRH agonists and GnRH antagonists. These medications have the opposite action on the GnRH receptor but paradoxically have the same therapeutic effects. GnRH agonists, such as leuprorelin (Lupron), goserelin (Zoladex), and buserelin (Suprefact), are GnRH receptor superagonists, and work by producing profound desensitization of the GnRH receptor such that the receptor becomes non-functional. This occurs because GnRH is normally released in pulses, but GnRH agonists are continuously present, and this results in excessive downregulation of the receptor and ultimately a complete loss of function.
Adrien-Marie Legendre (; French: [adʁiɛ̃ maʁi ləʒɑ̃dʁ]; 18 September 1752 – 9 January 1833) was a French mathematician who made numerous contributions to mathematics. Well-known and important concepts such as the Legendre polynomials and Legendre transformation are named after him. He is also known for his contributions to the method of least squares, and was the first to officially publish on it, though Carl Friedrich Gauss had discovered it before him.
Sources: en.wikipedia.org
A Ziehl–Neelsen stain is an acid-fast stain used to stain species of Mycobacterium tuberculosis that do not stain with the standard laboratory staining procedures such as Gram staining. This stain is performed through the use of both red coloured carbol fuchsin that stains the bacteria and a counter stain such as methylene blue.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Marlowe (1988), creator of Castle; writer of Air Force One, End of Days, and Hollow Man Lawrence Trilling (1988), showrunner of Parenthood and Goliath Maiken Baird (1989), documentary film producer, Client 9: The Rise and Fall of Eliot Spitzer Sam Bisbee (1990), Emmy Award-winning producer and composer Gina Fattore (1990), producer and writer of Dawson's Creek, Gilmore Girls, Parenthood, creator of Dare Me Jeff Rake (1990), television producer, writer of Boston Legal and creator of Manifest and The Mysteries of Laura Dede Gardner (1990), Academy Award-winning producer of 12 Years a Slave; president of Plan B Entertainment Jenji Kohan (1991), television writer, producer, creator of Orange Is the New Black and Weeds Ari Gold (1992), filmmaker, director of Adventures of Power Elizabeth Craft (1993), producer, screenwriter, Fantasy Island, The 100, Lie to Me Ethan McSweeny (1993), former artistic director of the American Shakespeare Center, recipient of a 2018 Helen Hayes Award Brian Yorkey (1993), playwright, co-winner of the 2010 Pulitzer Prize for Drama for writing the musical Next to Normal Anna Winger (1993), screenwriter, creator of miniseries Deutschland 83, Deutschland 86, and Unorthodox Imara Jones (1994), political journalist and director Nicole Kassell (1994), director and producer of Watchmen, winner of the 2020 Directors Guild of America Award for Outstanding Directing – Drama Series Tim Carvell (1995), head writer of The Daily Show and executive producer of Last Week Tonight with John Oliver Josh Fox (1995), Academy Award-nominated documentary director, Gasland Adam Egypt Mortimer (1995), director of Daniel Isn't Real, Archenemy Henry Alex Rubin (1995), Academy Award-nominated director, Murderball Julius Sharpe (1995), television writer and showrunner of Making History and United We Fall Ramin Bahrani (1996), writer-director of Man Push Cart, Chop Shop and Fahrenheit 451, 2021 Academy Award for Best Adapted Screenplay nominee Moira Demos (1996), filmmaker who produced Netflix documentary Making a Murderer Yana Gorskaya (1996), Academy Award-nominated film editor, Spellbound Cetywa Powell (1996), director and fine art photographer Courtney Lilly (1997), television producer, showrunner of Black-ish, Grown-ish, Mixed-ish Nancy Schwartzman (1997), director, Roll Red Roll Beau Willimon (1999), creator and producer of House of Cards; writer of the play Farragut North Vikram Gandhi (2000), director, Kumaré, Barry, reporter for Vice Andrew Goldberg (2000), creator of Netflix series Big Mouth Ned Benson (2001), director, The Disappearance of Eleanor Rigby Dan Harris (2001), Saturn Award-winning screenwriter, X2, Superman Returns; director, Imaginary Heroes Andrew Neel (2001), filmmaker, director of King Kelly, Goat Anna Boden (2002), co-writer of Half Nelson and director of Sugar, Captain Marvel Tze Chun (2002), award-winning director, Children of Invention Lang Fisher (2002), co-creator of Never Have I Ever, writer of 30 Rock and Brooklyn Nine-Nine, Peabody Award winner in 2008 Susanna Fogel (2002), Emmy Award and BAFTA Award-nominated director Will Graham (2002), creator of the Onion News Network, showrunner of Mozart in the Jungle, Peabody Award winner in 2008 Ashley Lyle (2002), screenwriter, showrunner of Yellowjackets Justin Marks (2002), screenwriter, The Jungle Book, Counterpart Katori Hall (2003), playwright, The Mountaintop, winner of the 2021 Pulitzer Prize for Drama Raamla Mohamed (2003), Emmy Award-nominated screenwriter, Little Fires Everywhere Graham Moore (2003), winner of the 2015 Academy Award for Best Adapted Screenplay for his screenplay of The Imitation Game Lucia Aniello (2004), director of Rough Night and Time Traveling Bong Gabe Liedman (2004), creator of Q-Force, writer of Brooklyn Nine-Nine, PEN15, Inside Amy Schumer and Kroll Show Zhang Mo (2005), Chinese director, daughter of Zhang Yimou Laura Goode (2006), author, columnist, and producer of Farah Goes Bang Matt Kaplan (2006), producer of young adult films, To All the Boys franchise Meera Menon (2006), Indian-American director, Equity Lilly Burns (2009), television producer, co-founder of Jax Media and president of Imagine Entertainment Eli Bush (2009), film and theatre producer and winner of the Golden Globe Award in 2018 for Lady Bird Jason Fuchs (2009), actor and screenwriter, Pan, Ice Age: Continental Drift Jessica Kingdon (2009), Academy Award-nominated Chinese-American documentary director Nuotama Bodomo (2010), Ghanaian filmmaker and co-writer of sketch comedy Random Acts of Flyness on HBO Sabaah Folayan (2013), director of documentary Whose Streets?
== Mechanism of action == The primary mechanism of action by PDRN is the adenosine A2A receptor pathway, which is activated following enzymatic degradation of the deoxyribonucleotide polymers. Adenosine acts the primary ligand which binds to the G protein-coupled receptor A2A leading to an increase in intracellular cyclic AMP (cAMP) levels. This secondary messenger activates protein kinase A (PKA) acting as a signaling cascade of several pathways downstream.Thus, enhacing tissue repair through upregulation of PI3K/Akt and vascular endothelial growth factor (VEGF). The activation of the A2A pathway is observed to be conserved across various PDRN sources, yet it activates different downstream pathways depending on the type of tissue and injury. Additionally, PDRN contributes to the salvage pathway, which is a metabolic mechanism that supports nucleotide synthesis for processes like DNA replication and celullar proliferation. For injuries needing faster regeneration, this nucleoside input is essential, highlighling the importance of both signaling and metabolic pathways for optimal tissue repair.
=== Remote vehicle disabling systems === Remote vehicle disabling systems provide users at remote locations the ability to prevent an engine from starting, prevent movement of a vehicle, and to stop or slow an operating vehicle. Remote disabling allows a dispatcher or other authorized personnel to gradually decelerate a vehicle by downshifting, limiting the throttle capability, or bleeding air from the braking system from a remote location. Some of these systems provide advance notification to the driver that the vehicle disabling is about to occur. After stopping a vehicle, some systems will lock the vehicle's brakes or will not allow the vehicle's engine to be restarted within a certain time-frame. Remote disabling systems can also be integrated into a remote panic and emergency notification system. In an emergency, a driver can send an emergency alert by pressing a panic button on the dashboard, or by using a key-fob panic button if the driver is within close proximity of the truck. Then, the carrier or other approved organization can be remotely alerted to allow a dispatcher or other authorized personnel to evaluate the situation, communicate with the driver, and/or potentially disable the vehicle.
Sources: en.wikipedia.org
Laboratory samples are often kept cool, dry, and protected from light, with frozen storage used for longer periods. Finished products should follow label instructions and avoid excessive heat or moisture.
High-performance liquid chromatography can assess purity, while mass spectrometry can confirm molecular identity. Nuclear magnetic resonance may also be used in research settings.
No. Regulatory status differs by country and can change, with some markets allowing supplement sales and others restricting it as a novel food or unapproved drug ingredient.
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ biosynthesis. It consists of nicotinamide, ribose, and phosphate groups.